CAMKV antibody (70R-3638)

Rabbit polyclonal CAMKV antibody raised against the N terminal of CAMKV

Synonyms Polyclonal CAMKV antibody, Anti-CAMKV antibody, CAMK5 antibody, VACAMKL antibody, 1G5 antibody, MGC8407 antibody, Cam Kinase-Like Vesicle-Associated antibody
Specificity CAMKV antibody was raised against the N terminal of CAMKV
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen CAMKV antibody was raised using the N terminal of CAMKV corresponding to a region with amino acids NRWLQSTNDSRFGHFRLSSGKFYGHKEKDKGLQTTQNGRFYAISARFKPF
Assay Information CAMKV Blocking Peptide, catalog no. 33R-6867, is also available for use as a blocking control in assays to test for specificity of this CAMKV antibody

Images

Western Blot analysis using CAMKV antibody (70R-3638)

CAMKV antibody (70R-3638) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 55 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of CAMKV antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance CAMKV does not appear to have detectable kinase activity.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using CAMKV antibody (70R-3638) | CAMKV antibody (70R-3638) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors