CANT1 antibody (70R-5808)

Rabbit polyclonal CANT1 antibody raised against the middle region of CANT1

Synonyms Polyclonal CANT1 antibody, Anti-CANT1 antibody, SCAN-1 antibody, Calcium Activated Nucleotidase 1 antibody, SHAPY antibody
Specificity CANT1 antibody was raised against the middle region of CANT1
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen CANT1 antibody was raised using the middle region of CANT1 corresponding to a region with amino acids SPDFGDIAVSHVGAVVPTHGFSSFKFIPNTDDQIIVALKSEEDSGRVASY
Assay Information CANT1 Blocking Peptide, catalog no. 33R-8666, is also available for use as a blocking control in assays to test for specificity of this CANT1 antibody

Images

Western Blot analysis using CANT1 antibody (70R-5808)

CANT1 antibody (70R-5808) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 45 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of CANT1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance CANT1 belongs to the apyrase family.It is a calcium-dependent nucleotidase with a preference for UDP. The order of activity with different substrates is UDP > GDP > UTP > GTP. The enzyme has very low activity towards ADP and even lower activity towards ATP.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using CANT1 antibody (70R-5808) | CANT1 antibody (70R-5808) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors