CANT1 antibody (70R-5814)

Rabbit polyclonal CANT1 antibody raised against the middle region of CANT1

Synonyms Polyclonal CANT1 antibody, Anti-CANT1 antibody, SHAPY antibody, SCAN-1 antibody, Calcium Activated Nucleotidase 1 antibody
Specificity CANT1 antibody was raised against the middle region of CANT1
Cross Reactivity Human
Applications WB
Immunogen CANT1 antibody was raised using the middle region of CANT1 corresponding to a region with amino acids VAVEWDKDHGVLESHLAEKGRGMELSDLIVFNGKLYSVDDRTGVVYQIEG
Assay Information CANT1 Blocking Peptide, catalog no. 33R-9442, is also available for use as a blocking control in assays to test for specificity of this CANT1 antibody


Western Blot analysis using CANT1 antibody (70R-5814)

CANT1 antibody (70R-5814) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 45 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of CANT1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance This protein encoded by this gene belongs to the apyrase family. It functions as a calcium-dependent nucleotidase with a preference for UDP. Mutations in this gene are associated with Desbuquois dysplasia with hand anomalies.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using CANT1 antibody (70R-5814) | CANT1 antibody (70R-5814) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors