CAP1 antibody (70R-5729)

Rabbit polyclonal CAP1 antibody

Synonyms Polyclonal CAP1 antibody, Anti-CAP1 antibody, Cap Adenylate Cyclase-Associated Protein 1 antibody, CAP antibody, CAP1-PEN antibody
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen CAP1 antibody was raised using a synthetic peptide corresponding to a region with amino acids KAQSGPVRSGPKPFSAPKPQTSPSPKRATKKEPAVLELEGKKWRVENQEN
Assay Information CAP1 Blocking Peptide, catalog no. 33R-4256, is also available for use as a blocking control in assays to test for specificity of this CAP1 antibody

Images

Western Blot analysis using CAP1 antibody (70R-5729)

CAP1 antibody (70R-5729) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 52 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of CAP1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The protein encoded by this gene is related to the S. cerevisiae CAP protein, which is involved in the cyclic AMP pathway. The human protein is able to interact with other molecules of the same protein, as well as with CAP2 and actin.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using CAP1 antibody (70R-5729) | CAP1 antibody (70R-5729) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors