Carbonic Anhydrase I antibody (70R-2203)

Rabbit polyclonal Carbonic Anhydrase I antibody raised against the N terminal of CA1

Synonyms Polyclonal Carbonic Anhydrase I antibody, Anti-Carbonic Anhydrase I antibody, Carbonic anhydrase 1 antibody, ECK0125 antibody, Car1 antibody, Carbonic anhydrase B antibody, Carbonate dehydratase I antibody, yadF antibody, CA1 antibody, Carbonic dehydratase antibody
Specificity Carbonic Anhydrase I antibody was raised against the N terminal of CA1
Cross Reactivity Human
Applications WB
Immunogen Carbonic Anhydrase I antibody was raised using the N terminal of CA1 corresponding to a region with amino acids ASPDWGYDDKNGPEQWSKLYPIANGNNQSPVDIKTSETKHDTSLKPISVS
Assay Information Carbonic Anhydrase I Blocking Peptide, catalog no. 33R-1519, is also available for use as a blocking control in assays to test for specificity of this Carbonic Anhydrase I antibody

Images

Western Blot analysis using Carbonic Anhydrase I antibody (70R-2203)

Carbonic Anhydrase I antibody (70R-2203) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 29 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of CA1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Carbonic anhydrases (CAs) are a large family of zinc metalloenzymes that catalyze the reversible hydration of carbon dioxide. They participate in a variety of biological processes, including respiration, calcification, acid-base balance, bone resorption, and the formation of aqueous humor, cerebrospinal fluid, saliva, and gastric acid. They show extensive diversity in tissue distribution and in their subcellular localization. CA1 is closely linked to CA2 and CA3 genes on chromosome 8, and it encodes a cytosolic protein which is found at the highest level in erythrocytes.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using Carbonic Anhydrase I antibody (70R-2203) | Carbonic Anhydrase I antibody (70R-2203) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors