Carbonic Anhydrase IV antibody (70R-7279)

Rabbit polyclonal Carbonic Anhydrase IV antibody raised against the C terminal of CA4

Synonyms Polyclonal Carbonic Anhydrase IV antibody, Anti-Carbonic Anhydrase IV antibody, CAIV antibody, RP17 antibody, Car4 antibody, CA4 antibody
Specificity Carbonic Anhydrase IV antibody was raised against the C terminal of CA4
Cross Reactivity Human
Applications WB
Immunogen Carbonic Anhydrase IV antibody was raised using the C terminal of CA4 corresponding to a region with amino acids AFSQKLYYDKEQTVSMKDNVRPLQQLGQRTVIKSGAPGRPLPWALPALLG
Assay Information Carbonic Anhydrase IV Blocking Peptide, catalog no. 33R-1176, is also available for use as a blocking control in assays to test for specificity of this Carbonic Anhydrase IV antibody

Images

Western Blot analysis using Carbonic Anhydrase IV antibody (70R-7279)

Carbonic Anhydrase IV antibody (70R-7279) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 34 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of CA4 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Carbonic anhydrases (CAs) are a large family of zinc metalloenzymes that catalyze the reversible hydration of carbon dioxide. They participate in a variety of biological processes, including respiration, calcification, acid-base balance, bone resorption, and the formation of aqueous humor, cerebrospinal fluid, saliva, and gastric acid. They show extensive diversity in tissue distribution and in their subcellular localization. CA4 is a glycosylphosphatidyl-inositol-anchored membrane isozyme expressed on the luminal surfaces of pulmonary (and certain other) capillaries and of proximal renal tubules. Its exact function is not known.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using Carbonic Anhydrase IV antibody (70R-7279) | Carbonic Anhydrase IV antibody (70R-7279) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors