Carbonyl Reductase 1 antibody (70R-1996)

Rabbit polyclonal Carbonyl Reductase 1 antibody raised against the middle region of CBR1

Synonyms Polyclonal Carbonyl Reductase 1 antibody, Anti-Carbonyl Reductase 1 antibody, Carbonyl Reductase -1, hCBR1 antibody, Carbonyl Reductase 1 antibody, CBR1 antibody, Carbonyl Reductase -1 antibody, Carbonyl Reductase 1, CBR antibody, Carbonyl Reductase 1
Specificity Carbonyl Reductase 1 antibody was raised against the middle region of CBR1
Cross Reactivity Human
Applications WB
Immunogen Carbonyl Reductase 1 antibody was raised using the middle region of CBR1 corresponding to a region with amino acids AEVTMKTNFFGTRDVCTELLPLIKPQGRVVNVSSIMSVRALKSCSPELQQ
Assay Information Carbonyl Reductase 1 Blocking Peptide, catalog no. 33R-1155, is also available for use as a blocking control in assays to test for specificity of this Carbonyl Reductase 1 antibody

Images

Western Blot analysis using Carbonyl Reductase 1 antibody (70R-1996)

Carbonyl Reductase 1 antibody (70R-1996) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 30 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of CBR1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Carbonyl reductase is one of several monomeric, NADPH-dependent oxidoreductases having wide specificity for carbonyl compounds. This enzyme is widely distributed in human tissues.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using Carbonyl Reductase 1 antibody (70R-1996) | Carbonyl Reductase 1 antibody (70R-1996) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors