Carbonyl Reductase 1 antibody (70R-1996)
Rabbit polyclonal Carbonyl Reductase 1 antibody raised against the middle region of CBR1
Overview
Overview
Synonyms | Polyclonal Carbonyl Reductase 1 antibody, Anti-Carbonyl Reductase 1 antibody, Carbonyl Reductase -1, hCBR1 antibody, Carbonyl Reductase 1 antibody, CBR1 antibody, Carbonyl Reductase -1 antibody, Carbonyl Reductase 1, CBR antibody, Carbonyl Reductase 1 |
---|---|
Specificity | Carbonyl Reductase 1 antibody was raised against the middle region of CBR1 |
Cross Reactivity | Human |
Applications | WB |
Immunogen | Carbonyl Reductase 1 antibody was raised using the middle region of CBR1 corresponding to a region with amino acids AEVTMKTNFFGTRDVCTELLPLIKPQGRVVNVSSIMSVRALKSCSPELQQ |
Assay Information | Carbonyl Reductase 1 Blocking Peptide, catalog no. 33R-1155, is also available for use as a blocking control in assays to test for specificity of this Carbonyl Reductase 1 antibody |
Images
Western Blot analysis using Carbonyl Reductase 1 antibody (70R-1996)
Carbonyl Reductase 1 antibody (70R-1996) used at 1 ug/ml to detect target protein.
Specifications
Host | Rabbit |
---|---|
Method of Purification | Affinity purified |
Molecular Weight | 30 kDa (MW of target protein) |
Form & Buffer | Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of CBR1 antibody in PBS |
Concentration | 1 mg/ml |
Usage & Assay Information
Usage Recommendations | WB: 1 ug/ml |
---|
Storage & Safety
Storage | Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles. |
---|
General Information
Biological Significance | Carbonyl reductase is one of several monomeric, NADPH-dependent oxidoreductases having wide specificity for carbonyl compounds. This enzyme is widely distributed in human tissues. |
---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product