Carboxylesterase 2 antibody (70R-3941)

Rabbit polyclonal Carboxylesterase 2 antibody

Synonyms Polyclonal Carboxylesterase 2 antibody, Anti-Carboxylesterase 2 antibody, Carboxylesterase -2 antibody, CES2 antibody, PCE-2 antibody, Carboxylesterase 2 antibody, iCE antibody, Carboxylesterase 2, CES2A1 antibody, CE-2 antibody, Carboxylesterase 2, Carboxylesterase -2
Cross Reactivity Human
Applications WB
Immunogen Carboxylesterase 2 antibody was raised using a synthetic peptide corresponding to a region with amino acids QHQPSWLKNIRPPHMKADHVKFTEEEEQLSRKMMKYWANFARNGNPNGEG
Assay Information Carboxylesterase 2 Blocking Peptide, catalog no. 33R-7582, is also available for use as a blocking control in assays to test for specificity of this Carboxylesterase 2 antibody

Images

Western Blot analysis using Carboxylesterase 2 antibody (70R-3941)

Carboxylesterase 2 antibody (70R-3941) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 67 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of CES2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Carboxylesterase 2 is a member of a large multigene family. The enzymes are responsible for the hydrolysis of ester- and amide-bond-containing drugs such as cocaine and heroin. They also hydrolize long-chain fatty acid esters and thioesters.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using Carboxylesterase 2 antibody (70R-3941) | Carboxylesterase 2 antibody (70R-3941) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors