Carboxypeptidase A1 antibody (70R-5489)

Rabbit polyclonal Carboxypeptidase A1 antibody

Synonyms Polyclonal Carboxypeptidase A1 antibody, Anti-Carboxypeptidase A1 antibody, CPA1 antibody, Pancreatic antibody
Cross Reactivity Human
Applications WB
Immunogen Carboxypeptidase A1 antibody was raised using a synthetic peptide corresponding to a region with amino acids QVLRISVADEAQVQKVKELEDLEHLQLDFWRGPAHPGSPIDVRVPFPSIQ
Assay Information Carboxypeptidase A1 Blocking Peptide, catalog no. 33R-7780, is also available for use as a blocking control in assays to test for specificity of this Carboxypeptidase A1 antibody


Western Blot analysis using Carboxypeptidase A1 antibody (70R-5489)

Carboxypeptidase A1 antibody (70R-5489) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 47 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of CPA1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Three different forms of human pancreatic procarboxypeptidase A have been isolated. The A1 and A2 forms are monomeric proteins with different biochemical properties. Carboxypeptidase A1 is a monomeric pancreatic exopeptidase. It is involved in zymogen inhibition.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using Carboxypeptidase A1 antibody (70R-5489) | Carboxypeptidase A1 antibody (70R-5489) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors