Carboxypeptidase E antibody (70R-5331)

Rabbit polyclonal Carboxypeptidase E antibody raised against the N terminal of CPE

Synonyms Polyclonal Carboxypeptidase E antibody, Anti-Carboxypeptidase E antibody, CPE antibody
Specificity Carboxypeptidase E antibody was raised against the N terminal of CPE
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen Carboxypeptidase E antibody was raised using the N terminal of CPE corresponding to a region with amino acids GMRRRRRLQQEDGISFEYHRYPELREALVSVWLQCTAISRIYTVGRSFEG
Assay Information Carboxypeptidase E Blocking Peptide, catalog no. 33R-3440, is also available for use as a blocking control in assays to test for specificity of this Carboxypeptidase E antibody

Images

Western Blot analysis using Carboxypeptidase E antibody (70R-5331)

Carboxypeptidase E antibody (70R-5331) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 52 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of CPE antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance CPE is a carboxypeptidase that cleaves C-terminal amino acid residues and is involved in the biosynthesis of peptide hormones and neurotransmitters, including insulin. It is a peripheral membrane protein. The protein specifically binds regulated secretory pathway proteins, including prohormones, but not constitutively secreted proteins.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using Carboxypeptidase E antibody (70R-5331) | Carboxypeptidase E antibody (70R-5331) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $375.00
Size: 50 ug
OR
Shipping
View Our Distributors