Carboxypeptidase N1 antibody (70R-5398)

Rabbit polyclonal Carboxypeptidase N1 antibody raised against the middle region of CPN1

Synonyms Polyclonal Carboxypeptidase N1 antibody, Anti-Carboxypeptidase N1 antibody, Carboxypeptidase N Polypeptide 1 antibody, CPN1 antibody, FLJ40792 antibody, Carboxypeptidase N1, CPN antibody, Carboxypeptidase N-1 antibody, Carboxypeptidase N 1, SCPN antibody, Carboxypeptidase N 1 antibody, Carboxypeptidase N-1
Specificity Carboxypeptidase N1 antibody was raised against the middle region of CPN1
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen Carboxypeptidase N1 antibody was raised using the middle region of CPN1 corresponding to a region with amino acids FQKLAKVYSYAHGWMFQGWNCGDYFPDGITNGASWYSLSKGMQDFNYLHT
Assay Information Carboxypeptidase N1 Blocking Peptide, catalog no. 33R-3033, is also available for use as a blocking control in assays to test for specificity of this Carboxypeptidase N1 antibody


Western blot analysis using Carboxypeptidase N1 antibody (70R-5398)

Recommended CPN1 Antibody Titration: 0.2-1 ug/ml


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 50 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of CPN1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Carboxypeptidase N is a plasma metallo-protease that cleaves basic amino acids from the C terminal of peptides and proteins. The enzyme is important in the regulation of peptides like kinins and anaphylatoxins, and has also been known as kininase-1 and anaphylatoxin inactivator. This enzyme is a tetramer comprised of two identical regulatory subunits and two identical catalytic subunits; this gene encodes the catalytic subunit. Mutations in this gene can be associated with angioedema or chronic urticaria resulting from carboxypeptidase N deficiency.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western blot analysis using Carboxypeptidase N1 antibody (70R-5398) | Recommended CPN1 Antibody Titration: 0.2-1 ug/ml
  • Immunohistochemical staining using Carboxypeptidase N1 antibody (70R-5398) | Heart

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors