CASD1 antibody (70R-7436)

Rabbit polyclonal CASD1 antibody raised against the N terminal of CASD1

Synonyms Polyclonal CASD1 antibody, Anti-CASD1 antibody, FLJ21213 antibody, CASD 1, FLJ21879 antibody, NBLA04196 antibody, CASD-1 antibody, C7orf12 antibody, CASD 1 antibody, CASD-1, CASD1, Cas1 Domain Containing 1 antibody, FLJ41901 antibody
Specificity CASD1 antibody was raised against the N terminal of CASD1
Cross Reactivity Human, Mouse, Rat
Applications WB
Immunogen CASD1 antibody was raised using the N terminal of CASD1 corresponding to a region with amino acids MAALAYNLGKREINHYFSVRSAKVLALVAVLLLAACHLASRRYRGNDSCE
Assay Information CASD1 Blocking Peptide, catalog no. 33R-5598, is also available for use as a blocking control in assays to test for specificity of this CASD1 antibody


Western Blot analysis using CASD1 antibody (70R-7436)

CASD1 antibody (70R-7436) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 91 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of CASD1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The function of CASD1 protein is not widely studied, and is yet to be elucidated fully.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using CASD1 antibody (70R-7436) | CASD1 antibody (70R-7436) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors