Catenin antibody (70R-2494)

Rabbit polyclonal Catenin antibody

Synonyms Polyclonal Catenin antibody, Anti-Catenin antibody, p120 antibody, Cadherin-Associated Protein Delta 2 antibody, CAS antibody, CTNND1 antibody, P120CTN antibody, P120CAS antibody, KIAA0384 antibody, CTNND antibody
Cross Reactivity Human, Mouse, Rat
Applications WB
Immunogen Catenin antibody was raised using a synthetic peptide corresponding to a region with amino acids YPPDGYSRHYEDGYPGGSDNYGSLSRVTRIEERYRPSMEGYRAPSRQDVY
Assay Information Catenin Blocking Peptide, catalog no. 33R-10205, is also available for use as a blocking control in assays to test for specificity of this Catenin antibody


Western Blot analysis using Catenin antibody (70R-2494)

Catenin antibody (70R-2494) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 93 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of CTNND1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance This gene encodes a member of the Armadillo protein family, which function in adhesion between cells and signal transduction. Multiple translation initiation codons and althernative splicing result in many different isoforms being translated.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using Catenin antibody (70R-2494) | Catenin antibody (70R-2494) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors