CBS antibody (70R-1025)

Rabbit polyclonal CBS antibody raised against the N terminal of CBS

Synonyms Polyclonal CBS antibody, Anti-CBS antibody, HIP4 antibody, Cystathionine-Beta-Synthase antibody
Specificity CBS antibody was raised against the N terminal of CBS
Cross Reactivity Human, Mouse, Rat, Dog
Applications IHC, WB
Immunogen CBS antibody was raised using the N terminal of CBS corresponding to a region with amino acids RCIIVMPEKMSSEKVDVLRALGAEIVRTPTNARFDSPESHVGVAWRLKNE
Assay Information CBS Blocking Peptide, catalog no. 33R-7836, is also available for use as a blocking control in assays to test for specificity of this CBS antibody

Images

Western Blot analysis using CBS antibody (70R-1025)

CBS antibody (70R-1025) used at 1.25 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 60 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of CBS antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1.25 ug/ml; IHC: 4-8 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance CBS is involved in the transsulfuration pathway. The first step of this pathway, from homocysteine to cystathionine, is catalyzed by this protein. CBS deficiency can cause homocystinuria which affects many organs and tissues, including the eyes and the skeletal, vascular and central nervous systems.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using CBS antibody (70R-1025) | CBS antibody (70R-1025) used at 1.25 ug/ml to detect target protein.
  • Immunohistochemical staining using CBS antibody (70R-1025) | CBS antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Epithelial cells of renal tubule (arrows)  in Human Kidney. Magnification is at 400X

Availability: In stock

Price: $275.00
Size: 100 ug
OR
Shipping
View Our Distributors