CCBE1 antibody (70R-4000)

Rabbit polyclonal CCBE1 antibody raised against the middle region of CCBE1

Synonyms Polyclonal CCBE1 antibody, Anti-CCBE1 antibody, Collagen And Calcium Binding Egf Domains 1 antibody, CCBE-1 antibody, CCBE1, MGC50861 antibody, CCBE-1, CCBE 1, CCBE 1 antibody, FLJ30681 antibody
Specificity CCBE1 antibody was raised against the middle region of CCBE1
Cross Reactivity Human
Applications WB
Immunogen CCBE1 antibody was raised using the middle region of CCBE1 corresponding to a region with amino acids PMGPSPDLSHIKQGRRGPVGPPGAPGRDGSKGERGAPGPRGSPGPPGSFD
Assay Information CCBE1 Blocking Peptide, catalog no. 33R-7221, is also available for use as a blocking control in assays to test for specificity of this CCBE1 antibody

Images

Western Blot analysis using CCBE1 antibody (70R-4000)

CCBE1 antibody (70R-4000) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 44 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of CCBE1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance This gene is thought to function in extracellular matrix remodeling and migration. It is predominantly expressed in the ovary, but down regulated in ovarian cancer cell lines and primary carcinomas, suggesting its role as a tumour suppressor. Mutations in this gene have been associated with Hennekam lymphangiectasia-lymphedema syndrome, a generalized lymphatic dysplasia in humans.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using CCBE1 antibody (70R-4000) | CCBE1 antibody (70R-4000) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors