CCBL2 antibody (70R-4897)

Rabbit polyclonal CCBL2 antibody raised against the C terminal of CCBL2

Synonyms Polyclonal CCBL2 antibody, Anti-CCBL2 antibody, CCBL 2, DKFZp547N1117 antibody, CCBL 2 antibody, CCBL2, RBM1 antibody, RBMXL1 antibody, KAT3 antibody, DKFZp667D0223 antibody, RP4-531M19.2 antibody, CCBL-2, MGC9398 antibody, CCBL-2 antibody, Cysteine Conjugate-Beta Lyase 2 antibody
Specificity CCBL2 antibody was raised against the C terminal of CCBL2
Cross Reactivity Human
Applications WB
Immunogen CCBL2 antibody was raised using the C terminal of CCBL2 corresponding to a region with amino acids LSAIPVSAFCNSETKSQFEKFVRFCFIKKDSTLDAAEEIIKAWSVQKS
Assay Information CCBL2 Blocking Peptide, catalog no. 33R-5406, is also available for use as a blocking control in assays to test for specificity of this CCBL2 antibody


Western Blot analysis using CCBL2 antibody (70R-4897)

CCBL2 antibody (70R-4897) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 48 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of CCBL2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance CCBL2 is an aminotransferase that transaminates kynurenine to form kynurenic acid. Kynurenic acid is a metabolite of tryptophan. Multiple alternatively spliced transcript variants that encode different proteins have been described for this gene. One of the transcripts encodes a predicted protein that has sequence identity to the protein encoded by the RNA binding motif protein, X-linked gene (RBMX).

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using CCBL2 antibody (70R-4897) | CCBL2 antibody (70R-4897) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors