CCDC11 antibody (70R-4249)

Rabbit polyclonal CCDC11 antibody raised against the N terminal of CCDC11

Synonyms Polyclonal CCDC11 antibody, Anti-CCDC11 antibody, Coiled-Coil Domain Containing 11 antibody, CCDC-11, FLJ32743 antibody, CCDC11, CCDC 11 antibody, CCDC 11, CCDC-11 antibody
Specificity CCDC11 antibody was raised against the N terminal of CCDC11
Cross Reactivity Human
Applications WB
Immunogen CCDC11 antibody was raised using the N terminal of CCDC11 corresponding to a region with amino acids YSQRFGTVQREVKGPTPKVVIVRSKPPKGQGAEHHLERIRRSHQKHNAIL
Assay Information CCDC11 Blocking Peptide, catalog no. 33R-10247, is also available for use as a blocking control in assays to test for specificity of this CCDC11 antibody

Images

Western Blot analysis using CCDC11 antibody (70R-4249)

CCDC11 antibody (70R-4249) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 62 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of CCDC11 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The function of the CCDC11 protein has not been widely studied, and is yet to be fully elucidated.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using CCDC11 antibody (70R-4249) | CCDC11 antibody (70R-4249) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors