CCDC128 antibody (70R-3189)

Rabbit polyclonal CCDC128 antibody raised against the N terminal of CCDC128

Synonyms Polyclonal CCDC128 antibody, Anti-CCDC128 antibody, FLJ16566 antibody, CCDC-128 antibody, Coiled-Coil Domain Containing 128 antibody, CCDC 128, CCDC-128, CCDC 128 antibody, CCDC128, MGC111781 antibody
Specificity CCDC128 antibody was raised against the N terminal of CCDC128
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen CCDC128 antibody was raised using the N terminal of CCDC128 corresponding to a region with amino acids KRVELLQDELALSEPRGKKNKKSGESSSQLSQEQKSVFDEDLQKKIEENE
Assay Information CCDC128 Blocking Peptide, catalog no. 33R-4637, is also available for use as a blocking control in assays to test for specificity of this CCDC128 antibody

Images

Western Blot analysis using CCDC128 antibody (70R-3189)

CCDC128 antibody (70R-3189) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 87 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of CCDC128 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The function of CCDC128 has not been widely studied, and is yet to be fully elucidated.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using CCDC128 antibody (70R-3189) | CCDC128 antibody (70R-3189) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors