CCDC19 antibody (70R-1957)

Rabbit polyclonal CCDC19 antibody raised against the N terminal of CCDC19

Synonyms Polyclonal CCDC19 antibody, Anti-CCDC19 antibody, CCDC19, CCDC-19, CCDC 19 antibody, CCDC-19 antibody, Coiled-Coil Domain Containing 19 antibody, CCDC 19, RP11-190A12.6 antibody, NESG1 antibody
Specificity CCDC19 antibody was raised against the N terminal of CCDC19
Cross Reactivity Human
Applications WB
Immunogen CCDC19 antibody was raised using the N terminal of CCDC19 corresponding to a region with amino acids SLIISPEEFERIKWASHVLTREELEARDQAFKKEKEATMDAVMTRKKIMK
Assay Information CCDC19 Blocking Peptide, catalog no. 33R-8593, is also available for use as a blocking control in assays to test for specificity of this CCDC19 antibody

Images

Western Blot analysis using CCDC19 antibody (70R-1957)

CCDC19 antibody (70R-1957) used at 0.5 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 50 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of CCDC19 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 0.5 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The function of CCDC19 protein is not widely studied, and is yet to be elucidated fully.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using CCDC19 antibody (70R-1957) | CCDC19 antibody (70R-1957) used at 0.5 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors