CCDC19 antibody (70R-4111)

Rabbit polyclonal CCDC19 antibody raised against the N terminal of CCDC19

Synonyms Polyclonal CCDC19 antibody, Anti-CCDC19 antibody, CCDC-19, NESG1 antibody, CCDC 19, CCDC 19 antibody, Coiled-Coil Domain Containing 19 antibody, CCDC-19 antibody, CCDC19
Specificity CCDC19 antibody was raised against the N terminal of CCDC19
Cross Reactivity Human
Applications WB
Immunogen CCDC19 antibody was raised using the N terminal of CCDC19 corresponding to a region with amino acids MPLSTAGILSSSSAASNRSRNKARYRTKAVSSEVDESLFGDIKSPAQGQS
Assay Information CCDC19 Blocking Peptide, catalog no. 33R-6295, is also available for use as a blocking control in assays to test for specificity of this CCDC19 antibody


Western Blot analysis using CCDC19 antibody (70R-4111)

CCDC19 antibody (70R-4111) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 66 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of CCDC19 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The function of CCDC19 protein is not widely studied, and is yet to be elucidated fully.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using CCDC19 antibody (70R-4111) | CCDC19 antibody (70R-4111) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors