CCDC25 antibody (70R-3622)

Rabbit polyclonal CCDC25 antibody raised against the middle region of CCDC25

Synonyms Polyclonal CCDC25 antibody, Anti-CCDC25 antibody, CCDC-25, CCDC 25, CCDC 25 antibody, Coiled-Coil Domain Containing 25 antibody, CCDC-25 antibody, CCDC25, FLJ10853 antibody
Specificity CCDC25 antibody was raised against the middle region of CCDC25
Cross Reactivity Human
Applications WB
Immunogen CCDC25 antibody was raised using the middle region of CCDC25 corresponding to a region with amino acids DLAAEKECRDREERNEKKAQIQEMKKREKEEMKKKREMDELRSYSSLMKV
Assay Information CCDC25 Blocking Peptide, catalog no. 33R-2035, is also available for use as a blocking control in assays to test for specificity of this CCDC25 antibody

Images

Western Blot analysis using CCDC25 antibody (70R-3622)

CCDC25 antibody (70R-3622) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 24 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of CCDC25 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The function of CCDC25 protein is not widely studied, and is yet to be elucidated fully.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using CCDC25 antibody (70R-3622) | CCDC25 antibody (70R-3622) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors