CCDC38 antibody (70R-3282)

Rabbit polyclonal CCDC38 antibody raised against the N terminal of CCDC38

Synonyms Polyclonal CCDC38 antibody, Anti-CCDC38 antibody, Coiled-Coil Domain Containing 38 antibody, CCDC-38 antibody, CCDC38, CCDC 38, FLJ40089 antibody, CCDC-38, CCDC 38 antibody
Specificity CCDC38 antibody was raised against the N terminal of CCDC38
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen CCDC38 antibody was raised using the N terminal of CCDC38 corresponding to a region with amino acids RERQLKKAEKKLQDDALAFEEFLRENDQRSVDALKMAAQETINKLQMTAE
Assay Information CCDC38 Blocking Peptide, catalog no. 33R-7886, is also available for use as a blocking control in assays to test for specificity of this CCDC38 antibody


Western Blot analysis using CCDC38 antibody (70R-3282)

CCDC38 antibody (70R-3282) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 65 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of CCDC38 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The specific function of CCDC38 is not yet known.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using CCDC38 antibody (70R-3282) | CCDC38 antibody (70R-3282) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors