CCDC46 antibody (70R-1954)

Rabbit polyclonal CCDC46 antibody raised against the C terminal of CCDC46

Synonyms Polyclonal CCDC46 antibody, Anti-CCDC46 antibody, FLJ39610 antibody, CCDC 46, CCDC 46 antibody, MGC33887 antibody, CCDC-46 antibody, Coiled-Coil Domain Containing 46 antibody, CCDC46, CCDC-46
Specificity CCDC46 antibody was raised against the C terminal of CCDC46
Cross Reactivity Human
Applications WB
Immunogen CCDC46 antibody was raised using the C terminal of CCDC46 corresponding to a region with amino acids IEKEYTQKLAKSSQIIAELQTTISSLKEENSQQQLAAERRLQDVRQKFED
Assay Information CCDC46 Blocking Peptide, catalog no. 33R-3942, is also available for use as a blocking control in assays to test for specificity of this CCDC46 antibody

Images

Western Blot analysis using CCDC46 antibody (70R-1954)

CCDC46 antibody (70R-1954) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 23 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of CCDC46 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance CCDC46 is a protein with filament, myosin tail and ATPase domains. Orthologs of the gene exist in mouse, rat and chimp.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using CCDC46 antibody (70R-1954) | CCDC46 antibody (70R-1954) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors