CCDC50 antibody (70R-2218)

Rabbit polyclonal CCDC50 antibody raised against the middle region of CCDC50

Synonyms Polyclonal CCDC50 antibody, Anti-CCDC50 antibody, CCDC 50 antibody, DFNA44 antibody, CCDC-50 antibody, CCDC 50, YMER antibody, Coiled-Coil Domain Containing 50 antibody, CCDC50, CCDC-50, C3orf6 antibody
Specificity CCDC50 antibody was raised against the middle region of CCDC50
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen CCDC50 antibody was raised using the middle region of CCDC50 corresponding to a region with amino acids GMKPRVMKEAVSTPSRMAHRDQEWYDAEIARKLQEEELLATQVDMRAAQV
Assay Information CCDC50 Blocking Peptide, catalog no. 33R-3435, is also available for use as a blocking control in assays to test for specificity of this CCDC50 antibody

Images

Western Blot analysis using CCDC50 antibody (70R-2218)

CCDC50 antibody (70R-2218) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 56 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of CCDC50 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance CCDC50 is a soluble, cytoplasmic, tyrosine-phosphorylated protein with multiple ubiquitin-interacting domains. Mutations in this gene cause nonsyndromic, postlingual, progressive sensorineural DFNA44 hearing loss. In mouse, the protein is expressed in the inner ear during development and postnatal maturation and associates with microtubule-based structures. This protein may also function as a negative regulator of NF-kB signaling and as an effector of epidermal growth factor (EGF)-mediated cell signaling.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using CCDC50 antibody (70R-2218) | CCDC50 antibody (70R-2218) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors