CCDC52 antibody (70R-3812)

Rabbit polyclonal CCDC52 antibody raised against the middle region of CCDC52

Synonyms Polyclonal CCDC52 antibody, Anti-CCDC52 antibody, Coiled-Coil Domain Containing 52 antibody, FLJ26064 antibody, CCDC-52, CCDC 52 antibody, CCDC-52 antibody, CCDC 52, FLJ44949 antibody, CCDC52
Specificity CCDC52 antibody was raised against the middle region of CCDC52
Cross Reactivity Human,Mouse
Applications WB
Immunogen CCDC52 antibody was raised using the middle region of CCDC52 corresponding to a region with amino acids KEQNWEEKTLPIDTDIQNSSEENRLFTQRWRVSHMGEDLENKTQAPFVNL
Assay Information CCDC52 Blocking Peptide, catalog no. 33R-4352, is also available for use as a blocking control in assays to test for specificity of this CCDC52 antibody

Images

Western Blot analysis using CCDC52 antibody (70R-3812)

CCDC52 antibody (70R-3812) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 96 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of CCDC52 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The specific function of CCDC52 is not yet known.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using CCDC52 antibody (70R-3812) | CCDC52 antibody (70R-3812) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors