CCDC54 antibody (70R-3303)

Rabbit polyclonal CCDC54 antibody raised against the N terminal of CCDC54

Synonyms Polyclonal CCDC54 antibody, Anti-CCDC54 antibody, CCDC-54 antibody, CCDC-54, Coiled-Coil Domain Containing 54 antibody, CCDC 54, CCDC 54 antibody, CCDC54, NYD-SP17 antibody, FLJ25362 antibody
Specificity CCDC54 antibody was raised against the N terminal of CCDC54
Cross Reactivity Human
Applications WB
Immunogen CCDC54 antibody was raised using the N terminal of CCDC54 corresponding to a region with amino acids MPFGCVTLGDKKNYNQPSEVTDRYDLGQVIKTEEFCEIFRAKDKTTGKLH
Assay Information CCDC54 Blocking Peptide, catalog no. 33R-6277, is also available for use as a blocking control in assays to test for specificity of this CCDC54 antibody


Western Blot analysis using CCDC54 antibody (70R-3303)

CCDC54 antibody (70R-3303) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 36 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of CCDC54 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The specific function of CCDC54 is not yet known.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using CCDC54 antibody (70R-3303) | CCDC54 antibody (70R-3303) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors