CCDC60 antibody (70R-4198)

Rabbit polyclonal CCDC60 antibody raised against the C terminal of CCDC60

Synonyms Polyclonal CCDC60 antibody, Anti-CCDC60 antibody, CCDC 60 antibody, CCDC-60 antibody, CCDC-60, MGC39827 antibody, CCDC 60, CCDC60, Coiled-Coil Domain Containing 60 antibody
Specificity CCDC60 antibody was raised against the C terminal of CCDC60
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen CCDC60 antibody was raised using the C terminal of CCDC60 corresponding to a region with amino acids RPAKKILVKLQKFGENLDLRIRPHVLLKVLQDLRIWELCSPDIAVAIEFV
Assay Information CCDC60 Blocking Peptide, catalog no. 33R-8088, is also available for use as a blocking control in assays to test for specificity of this CCDC60 antibody


Western Blot analysis using CCDC60 antibody (70R-4198)

CCDC60 antibody (70R-4198) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 63 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of CCDC60 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The function of CCDC60 protein has not been widely studied, and is yet to be fully elucidated.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using CCDC60 antibody (70R-4198) | CCDC60 antibody (70R-4198) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors