CCDC7 antibody (70R-4211)

Rabbit polyclonal CCDC7 antibody raised against the N terminal of CCDC7

Synonyms Polyclonal CCDC7 antibody, Anti-CCDC7 antibody, FLJ32762 antibody, CCDC-7, BioT2-A antibody, CCDC 7, RP11-479G22.1 antibody, DKFZp686N0559 antibody, CCDC 7 antibody, Coiled-Coil Domain Containing 7 antibody, BioT2-B antibody, BioT2-C antibody, CCDC-7 antibody, CCDC7
Specificity CCDC7 antibody was raised against the N terminal of CCDC7
Cross Reactivity Human
Applications WB
Immunogen CCDC7 antibody was raised using the N terminal of CCDC7 corresponding to a region with amino acids KHNAKLIHDKIEPMVLRSPPTGESILRYALPIPSSKTKNLLPEDEMIGKI
Assay Information CCDC7 Blocking Peptide, catalog no. 33R-4415, is also available for use as a blocking control in assays to test for specificity of this CCDC7 antibody


Western Blot analysis using CCDC7 antibody (70R-4211)

CCDC7 antibody (70R-4211) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 56 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of CCDC7 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The function of CCDC7 protein has not been widely studied, and is yet to be fully elucidated.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using CCDC7 antibody (70R-4211) | CCDC7 antibody (70R-4211) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors