CCDC76 antibody (70R-4522)

Rabbit polyclonal CCDC76 antibody raised against the N terminal of CCDC76

Synonyms Polyclonal CCDC76 antibody, Anti-CCDC76 antibody, Coiled-Coil Domain Containing 76 antibody, CCDC 76, FLJ11219 antibody, CCDC 76 antibody, CCDC-76, FLJ10287 antibody, CCDC-76 antibody, CCDC76
Specificity CCDC76 antibody was raised against the N terminal of CCDC76
Cross Reactivity Human
Applications WB
Immunogen CCDC76 antibody was raised using the N terminal of CCDC76 corresponding to a region with amino acids QLAKHLKKCNSREKPKPDFYIQDINAGLRDETEIPEQLVPISSLSEEQLE
Assay Information CCDC76 Blocking Peptide, catalog no. 33R-7618, is also available for use as a blocking control in assays to test for specificity of this CCDC76 antibody

Images

Western Blot analysis using CCDC76 antibody (70R-4522)

CCDC76 antibody (70R-4522) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 54 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of CCDC76 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance CCDC76 specifically methylates guanosine-4 in various tRNAs with a Gly(CCG), His or Pro signature.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using CCDC76 antibody (70R-4522) | CCDC76 antibody (70R-4522) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors