CCDC78 antibody (70R-3751)

Rabbit polyclonal CCDC78 antibody raised against the middle region of CCDC78

Synonyms Polyclonal CCDC78 antibody, Anti-CCDC78 antibody, Coiled-Coil Domain Containing 78 antibody, CCDC 78 antibody, CCDC-78 antibody, CCDC78, C16orf25 antibody, CCDC-78, CCDC 78, JFP10 antibody, FLJ34512 antibody
Specificity CCDC78 antibody was raised against the middle region of CCDC78
Cross Reactivity Human
Applications WB
Immunogen CCDC78 antibody was raised using the middle region of CCDC78 corresponding to a region with amino acids QELRHKAQVPGHSDDHRFQVQPKNTMDPENEQHRLGSGVSVQPPSSGERA
Assay Information CCDC78 Blocking Peptide, catalog no. 33R-7533, is also available for use as a blocking control in assays to test for specificity of this CCDC78 antibody

Images

Western Blot analysis using CCDC78 antibody (70R-3751)

CCDC78 antibody (70R-3751) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 37 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of CCDC78 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The function of CCDC78 protein has not been widely studied, and is yet to be fully elucidated.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using CCDC78 antibody (70R-3751) | CCDC78 antibody (70R-3751) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors