CCDC90A antibody (70R-6728)

Rabbit polyclonal CCDC90A antibody raised against the middle region of CCDC90A

Synonyms Polyclonal CCDC90A antibody, Anti-CCDC90A antibody, CCDCA 90, CCDCA-90 antibody, Coiled-Coil Domain Containing 90A antibody, C6orf79 antibody, CCDC90A, CCDCA-90, FLJ20958 antibody, CCDCA 90 antibody
Specificity CCDC90A antibody was raised against the middle region of CCDC90A
Cross Reactivity Human
Applications WB
Immunogen CCDC90A antibody was raised using the middle region of CCDC90A corresponding to a region with amino acids ELHQLKQQVMDEVIKVRTDTKLDFNLEKSRVKELYSLNEKKLLELRTEIV
Assay Information CCDC90A Blocking Peptide, catalog no. 33R-2548, is also available for use as a blocking control in assays to test for specificity of this CCDC90A antibody

Images

Western Blot analysis using CCDC90A antibody (70R-6728)

CCDC90A antibody (70R-6728) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 40 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of CCDC90A antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The function of CCDC90A protein has not been widely studied, and is yet to be fully elucidated.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using CCDC90A antibody (70R-6728) | CCDC90A antibody (70R-6728) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors