Ccl11 Blocking Peptide (33R-10359)

A synthetic peptide for use as a blocking control in assays to test for specificity of Ccl11 antibody, catalog no. 70R-7852

Synonyms Ccl11 control peptide, Ccl11 antibody Blocking Peptide, Anti-Ccl11 Blocking Peptide, chemokine, C-C motif ligand 11 Blocking Peptide, Scya11 Blocking Peptide, eotaxin Blocking Peptide, Ccl11, Ccl-11, Ccl 11, Ccl-11 Blocking Peptide, Ccl 11 Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues LKSYKRITNNRCTLKAIVFKTRLGKEICADPKKKWVQDATKHLDQKLQTP
Molecular Weight 11 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance In response to the presence of allergens, this protein directly promotes the accumulation of eosinophils (a prominent feature of allergic inflammatory reactions), but not lymphocytes, macrophages or neutrophils.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: $130.00
Size: 100 ug
OR
Shipping
View Our Distributors