CCRL1 Blocking Peptide (33R-10400)

A synthetic peptide for use as a blocking control in assays to test for specificity of CCRL1 antibody, catalog no. 70R-10415

Synonyms CCRL1 control peptide, CCRL1 antibody Blocking Peptide, Anti-CCRL1 Blocking Peptide, chemokine, C-C motif receptor-like 1 Blocking Peptide, CC-CKR-11 Blocking Peptide, CCBP2 Blocking Peptide, CCR10 Blocking Peptide, CCR11 Blocking Peptide, CCX-CKR Blocking Peptide, CKR-11 Blocking Peptide, PPR1 Blocking Peptide, VSHK1 Blocking Peptide, CCRL1, CCRL-1, CCRL 1, CCRL-1 Blocking Peptide, CCRL 1 Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues SIALFHSCLNPILYVFMGASFKNYVMKVAKKYGSWRRQRQSVEEFPFDSE
Molecular Weight 39 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The protein encoded by this gene is a member of the G protein-coupled receptor family, and is a receptor for C-C type chemokines. This receptor has been shown to bind dendritic cell- and T cell-activated chemokines including CCL19/ELC, CCL21/SLC, and CCL25/TECK. Alternatively spliced transcript variants encoding the same protein have been described.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: $130.00
Size: 100 ug
OR
Shipping
View Our Distributors