CCRL2 antibody (70R-5949)

Rabbit polyclonal CCRL2 antibody

Synonyms Polyclonal CCRL2 antibody, Anti-CCRL2 antibody, HCR antibody, CRAM-A antibody, MGC116710 antibody, CRAM-B antibody, Chemokine antibody, CKRX antibody, C-C Motif Receptor-Like 2 antibody
Cross Reactivity Human
Applications WB
Immunogen CCRL2 antibody was raised using a synthetic peptide corresponding to a region with amino acids LSAQLVPSLCSAVFVIGVLDNLLVVLILVKYKGLKRVENIYLLNLAVSNL
Assay Information CCRL2 Blocking Peptide, catalog no. 33R-5410, is also available for use as a blocking control in assays to test for specificity of this CCRL2 antibody

Images

Western Blot analysis using CCRL2 antibody (70R-5949)

CCRL2 antibody (70R-5949) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 39 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of CCRL2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance CCRL2 is a chemokine receptor like protein, which is predicted to be a seven transmembrane protein and most closely related to CCR1. Chemokines and their receptors mediated signal transduction are critical for the recruitment of effector immune cells to the site of inflammation. CCRL2 gene is expressed at high levels in primary neutrophils and primary monocytes, and is further upregulated on neutrophil activation and during monocyte to macrophage differentiation. The function of this gene is unknown.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using CCRL2 antibody (70R-5949) | CCRL2 antibody (70R-5949) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors