CCT6B antibody (70R-4432)

Rabbit polyclonal CCT6B antibody

Synonyms Polyclonal CCT6B antibody, Anti-CCT6B antibody, TSA303 antibody, TCP-1-zeta-2 antibody, Cctz2 antibody, Chaperonin Containing Tcp1 Subunit 6B antibody, CCT-zeta-2 antibody, CCTZ-2 antibody
Cross Reactivity Human
Applications WB
Immunogen CCT6B antibody was raised using a synthetic peptide corresponding to a region with amino acids VARTSLQTKVHAELADVLTEVVVDSVLAVRRPGYPIDLFMVEIMEMKHKL
Assay Information CCT6B Blocking Peptide, catalog no. 33R-9436, is also available for use as a blocking control in assays to test for specificity of this CCT6B antibody

Images

Western Blot analysis using CCT6B antibody (70R-4432)

CCT6B antibody (70R-4432) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 58 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of CCT6B antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance CCT6B is a molecular chaperone that is a member of the chaperonin containing TCP1 complex (CCT), also known as the TCP1 ring complex (TRiC). This complex consists of two identical stacked rings, each containing eight different proteins. Unfolded polypeptides enter the central cavity of the complex and are folded in an ATP-dependent manner. The complex folds various proteins, including actin and tubulin.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using CCT6B antibody (70R-4432) | CCT6B antibody (70R-4432) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors