CCT8 antibody (70R-3562)

Rabbit polyclonal CCT8 antibody

Synonyms Polyclonal CCT8 antibody, Anti-CCT8 antibody, D21S246 antibody, Cctq antibody, KIAA0002 antibody, Chaperonin Containing Tcp1 Subunit 8 antibody
Cross Reactivity Human,Mouse,Rat,Dog
Applications WB
Immunogen CCT8 antibody was raised using a synthetic peptide corresponding to a region with amino acids DMLEAGILDTYLGKYWAIKLATNAAVTVLRVDQIIMAKPAGGPKPPSGKK
Assay Information CCT8 Blocking Peptide, catalog no. 33R-2076, is also available for use as a blocking control in assays to test for specificity of this CCT8 antibody


Western Blot analysis using CCT8 antibody (70R-3562)

CCT8 antibody (70R-3562) used at 0.5 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 59 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of CCT8 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 0.5 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance As a molecular chaperone; CCT8 assists the folding of proteins upon ATP hydrolysis. It is known to play a role, in vitro, in the folding of actin and tubulin.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using CCT8 antibody (70R-3562) | CCT8 antibody (70R-3562) used at 0.5 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors