CCT8L2 antibody (70R-5062)

Rabbit polyclonal CCT8L2 antibody

Synonyms Polyclonal CCT8L2 antibody, Anti-CCT8L2 antibody, Chaperonin Containing Tcp1 Subunit 8 antibody, MGC118840 antibody, MGC118839 antibody, CESK1 antibody
Cross Reactivity Human
Applications WB
Immunogen CCT8L2 antibody was raised using a synthetic peptide corresponding to a region with amino acids AGINVAVVLGEVDEETLTLADKYGIVVIQARSWMEIIYLSEVLDTPLLPR
Assay Information CCT8L2 Blocking Peptide, catalog no. 33R-1202, is also available for use as a blocking control in assays to test for specificity of this CCT8L2 antibody


Western Blot analysis using CCT8L2 antibody (70R-5062)

CCT8L2 antibody (70R-5062) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 59 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of CCT8L2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance CCT8L2 belongs to the TCP-1 chaperonin family. It possible molecular chaperone and assists the folding of proteins upon ATP hydrolysis.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using CCT8L2 antibody (70R-5062) | CCT8L2 antibody (70R-5062) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors