CD160 antibody (70R-5801)

Rabbit polyclonal CD160 antibody raised against the middle region of CD160

Synonyms Polyclonal CD160 antibody, Anti-CD160 antibody, NK28 antibody, Cd160 Molecule antibody, NK1 antibody, CD-160, CD 160, FLJ46513 antibody, BY55 antibody, CD 160 antibody, CD-160 antibody, CD160
Specificity CD160 antibody was raised against the middle region of CD160
Cross Reactivity Human
Applications WB
Immunogen CD160 antibody was raised using the middle region of CD160 corresponding to a region with amino acids SGTYQCCARSQKSGIRLQGHFFSILFTETGNYTVTGLKQRQHLEFSHNEG
Assay Information CD160 Blocking Peptide, catalog no. 33R-8498, is also available for use as a blocking control in assays to test for specificity of this CD160 antibody

Images

Western Blot analysis using CD160 antibody (70R-5801)

CD160 antibody (70R-5801) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 20 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of CD160 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance CD160 is an 27 kDa glycoprotein which was initially identified with the monoclonal antibody BY55. Its expression is tightly associated with peripheral blood NK cells and CD8 T lymphocytes with cytolytic effector activity.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using CD160 antibody (70R-5801) | CD160 antibody (70R-5801) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors