CD36 antibody (70R-6098)

Rabbit polyclonal CD36 antibody

Synonyms Polyclonal CD36 antibody, Anti-CD36 antibody, Thrombospondin Receptor antibody, CHDS7 antibody, Cd36 Molecule antibody, SCARB3 antibody, GPIV antibody, CD 36 antibody, CD-36, CD36, GP4 antibody, CD 36, PASIV antibody, CD-36 antibody, GP3B antibody, FAT antibody
Cross Reactivity Human
Applications WB
Immunogen CD36 antibody was raised using a synthetic peptide corresponding to a region with amino acids KTIKKQVVLEEGTIAFKNWVKTGTEVYRQFWIFDVQNPQEVMMNSSNIQV
Assay Information CD36 Blocking Peptide, catalog no. 33R-4679, is also available for use as a blocking control in assays to test for specificity of this CD36 antibody


Immunofluorescent staining using CD36 antibody (70R-6098)

CD36 antibody used at a concentration of 2 and 10 ug/ml to detect gut tissue. Goat anti-Rabbit (Cy3) was used at 1:200.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 53 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of CD36 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance CD36 is the fourth major glycoprotein of the platelet surface and serves as a receptor for thrombospondin in platelets and various cell lines. Since thrombospondins are widely distributed proteins involved in a variety of adhesive processes, this protein may have important functions as a cell adhesion molecule. It binds to collagen, thrombospondin, anionic phospholipids and oxidized LDL. It directly mediates cytoadherence of Plasmodium falciparum parasitized erythrocytes and it binds long chain fatty acids and may function in the transport and/or as a regulator of fatty acid transport. Mutations in its gene cause platelet glycoprotein deficiency.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Immunofluorescent staining using CD36 antibody (70R-6098) | CD36 antibody used at a concentration of 2 and 10 ug/ml to detect gut tissue. Goat anti-Rabbit (Cy3) was used at 1:200.
  • Western Blot analysis using CD36 antibody (70R-6098) | CD36 antibody (70R-6098) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors