CD36 antibody (70R-6104)

Rabbit polyclonal CD36 antibody

Synonyms Polyclonal CD36 antibody, Anti-CD36 antibody, CD 36, CD-36 antibody, SCARB3 antibody, CD-36, GP4 antibody, CD 36 antibody, GPIV antibody, CHDS7 antibody, Thrombospondin Receptor antibody, CD36, FAT antibody, PASIV antibody, GP3B antibody, Cd36 Molecule antibody
Cross Reactivity Human
Applications IHC, WB
Immunogen CD36 antibody was raised using a synthetic peptide corresponding to a region with amino acids MGCDRNCGLIAGAVIGAVLAVFGGILMPVGDLLIQKTIKKQVVLEEGTIA
Assay Information CD36 Blocking Peptide, catalog no. 33R-6013, is also available for use as a blocking control in assays to test for specificity of this CD36 antibody

Images

Immunohistochemical staining using CD36 antibody (70R-6104)

CD36 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml. Magnification is at 400X

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 53 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of CD36 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 0.2-1 ug/ml; IHC: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance CD36 is the fourth major glycoprotein of the platelet surface and serves as a receptor for thrombospondin in platelets and various cell lines. Since thrombospondins are widely distributed proteins involved in a variety of adhesive processes, this protein may have important functions as a cell adhesion molecule. It binds to collagen, thrombospondin, anionic phospholipids and oxidized LDL. It directly mediates cytoadherence of Plasmodium falciparum parasitized erythrocytes and it binds long chain fatty acids and may function in the transport and/or as a regulator of fatty acid transport. Mutations in its gene cause platelet glycoprotein deficiency.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Immunohistochemical staining using CD36 antibody (70R-6104) | CD36 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml. Magnification is at 400X
  • Western Blot analysis using CD36 antibody (70R-6104) | Western Blot showing CD36 antibody used at a concentration of 1-2 ug/ml to detect its target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors