CD40 antibody (70R-5925)

Rabbit polyclonal CD40 antibody raised against the N terminal of CD40

Synonyms Polyclonal CD40 antibody, Anti-CD40 antibody, CD 40, Cd40 Molecule Tnf Receptor Superfamily Member 5 antibody, CD 40 antibody, CD-40, CD-40 antibody, CD40, p50 antibody, MGC9013 antibody, TNFRSF5 antibody, CDW40 antibody, Bp50 antibody
Specificity CD40 antibody was raised against the N terminal of CD40
Cross Reactivity Human
Applications WB
Immunogen CD40 antibody was raised using the N terminal of CD40 corresponding to a region with amino acids SQCCSLCQPGQKLVSDCTEFTETECLPCGESEFLDTWNRETHCHQHKYCD
Assay Information CD40 Blocking Peptide, catalog no. 33R-8706, is also available for use as a blocking control in assays to test for specificity of this CD40 antibody

Images

Western Blot analysis using CD40 antibody (70R-5925)

CD40 antibody (70R-5925) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 20 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of CD40 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance CD40 is the receptor for TNFSF5/CD40LG. Defects in CD40 are the cause of hyper-IgM immunodeficiency type 3 (HIGM3).

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using CD40 antibody (70R-5925) | CD40 antibody (70R-5925) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors