CD40 antibody (70R-6008)

Rabbit polyclonal CD40 antibody raised against the N terminal of CD40

Synonyms Polyclonal CD40 antibody, Anti-CD40 antibody, CD 40 antibody, CD-40 antibody, CD40, p50 antibody, CDW40 antibody, TNFRSF5 antibody, CD-40, Cd40 Molecule Tnf Receptor Superfamily Member 5 antibody, Bp50 antibody, MGC9013 antibody, CD 40
Specificity CD40 antibody was raised against the N terminal of CD40
Cross Reactivity Human
Applications WB
Immunogen CD40 antibody was raised using the N terminal of CD40 corresponding to a region with amino acids WNRETHCHQHKYCDPNLGLRVQQKGTSETDTICTCEEGWHCTSEACESCV
Assay Information CD40 Blocking Peptide, catalog no. 33R-9985, is also available for use as a blocking control in assays to test for specificity of this CD40 antibody

Images

Western Blot analysis using CD40 antibody (70R-6008)

CD40 antibody (70R-6008) used at 0.25 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 30 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of CD40 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 0.25 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance CD40 is a member of the TNF-receptor superfamily. This receptor has been found to be essential in mediating a broad variety of immune and inflammatory responses including T cell-dependent immunoglobulin class switching, memory B cell development, and germinal center formation. AT-hook transcription factor AKNA is reported to coordinately regulate the expression of this receptor and its ligand, which may be important for homotypic cell interactions. Adaptor protein TNFR2 interacts with this receptor and serves as a mediator of the signal transduction. The interaction of this receptor and its ligand is found to be necessary for amyloid-beta-induced microglial activation, and thus is thought to be an early event in Alzheimer disease pathogenesis.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using CD40 antibody (70R-6008) | CD40 antibody (70R-6008) used at 0.25 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors