CD40L antibody (70R-6092)

Rabbit polyclonal CD40L antibody

Synonyms Polyclonal CD40L antibody, Anti-CD40L antibody, CD40L antibody, CD154 antibody, gp39 antibody, CD-40 antibody, CD-40, IGM antibody, CD 40, IMD3 antibody, T-BAM antibody, TNFSF5 antibody, TRAP antibody, CD 40 antibody, HIGM1 antibody, CD40, Tnf Superfamily 5 Hyper-Igm Syndrome antibody, hCD40L antibody, Cd40 Ligand antibody
Cross Reactivity Human
Applications WB
Immunogen CD40L antibody was raised using a synthetic peptide corresponding to a region with amino acids ENSFEMQKGDQNPQIAAHVISEASSKTTSVLQWAEKGYYTMSNNLVTLEN
Assay Information CD40L Blocking Peptide, catalog no. 33R-2615, is also available for use as a blocking control in assays to test for specificity of this CD40L antibody

Images

Western Blot analysis using CD40L antibody (70R-6092)

CD40L antibody (70R-6092) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 29 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of CD40LG antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance CD40LG is expressed on the surface of T cells. It regulates B cell function by engaging CD40 on the B cell surface. A defect in this gene results in an inability to undergo immunoglobulin class switch and is associated with hyper-IgM syndrome.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using CD40L antibody (70R-6092) | CD40L antibody (70R-6092) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors