CD5 antibody (70R-6188)

Rabbit polyclonal CD5 antibody raised against the N terminal of CD5

Synonyms Polyclonal CD5 antibody, Anti-CD5 antibody, CD 5 antibody, CD-5 antibody, Cd5 Molecule antibody, CD-5, T1 antibody, LEU1 antibody, Ly1 antibody, CD5, CD 5
Specificity CD5 antibody was raised against the N terminal of CD5
Cross Reactivity Human
Applications WB
Immunogen CD5 antibody was raised using the N terminal of CD5 corresponding to a region with amino acids MPMGSLQPLATLYLLGMLVASCLGRLSWYDPDFQARLTRSNSKCQGQLEV
Assay Information CD5 Blocking Peptide, catalog no. 33R-6297, is also available for use as a blocking control in assays to test for specificity of this CD5 antibody


Western Blot analysis using CD5 antibody (70R-6188)

CD5 antibody (70R-6188) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 54 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of CD5 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance CD5 may act as a receptor in regulating T-cell proliferation. CD5 interacts with CD72/LYB-2.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using CD5 antibody (70R-6188) | CD5 antibody (70R-6188) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors