CD70 Blocking Peptide (33R-10423)

A synthetic peptide for use as a blocking control in assays to test for specificity of CD70 antibody, catalog no. 70R-10290

Synonyms CD70 control peptide, CD70 antibody Blocking Peptide, Anti-CD70 Blocking Peptide, CD70 molecule Blocking Peptide, CD27L Blocking Peptide, CD27LG Blocking Peptide, TNFSF7 Blocking Peptide, CD70, CD-70, CD 70, CD-70 Blocking Peptide, CD 70 Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues VICLVVCIQRFAQAQQQLPLESLGWDVAELQLNHTGPQQDPRLYWQGGPA
Molecular Weight 21 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The protein encoded by this gene is a cytokine that belongs to the tumor necrosis factor (TNF) ligand family. This cytokine is a ligand for TNFRSF27/CD27. It is a surface antigen on activated, but not on resting, T and B lymphocytes. It induces proliferation of costimulated T cells, enhances the generation of cytolytic T cells, and contributes to T cell activation. This cytokine is also reported to play a role in regulating B-cell activation, cytotoxic function of natural killer cells, and immunoglobulin sythesis.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: $130.00
Size: 100 ug
OR
Shipping
View Our Distributors