CD8B antibody (70R-5987)

Rabbit polyclonal CD8B antibody raised against the middle region of CD8B

Synonyms Polyclonal CD8B antibody, Anti-CD8B antibody, LYT3 antibody, CD8B1 antibody, Leu2 antibody, Cd8B Molecule antibody, CDB 8 antibody, CDB-8, CDB 8, Ly3 antibody, MGC119115 antibody, CD8B, CDB-8 antibody
Specificity CD8B antibody was raised against the middle region of CD8B
Cross Reactivity Human
Applications WB
Immunogen CD8B antibody was raised using the middle region of CD8B corresponding to a region with amino acids KPEDSGIYFCMIVGSPELTFGKGTQLSVVDFLPTTAQPTKKSTLKKRVCR
Assay Information CD8B Blocking Peptide, catalog no. 33R-4582, is also available for use as a blocking control in assays to test for specificity of this CD8B antibody

Images

Western Blot analysis using CD8B antibody (70R-5987)

CD8B antibody (70R-5987) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 21 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of CD8B antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The CD8 antigen is a cell surface glycoprotein found on most cytotoxic T lymphocytes that mediates efficient cell-cell interactions within the immune system. The CD8 antigen, acting as a coreceptor, and the T-cell receptor on the T lymphocyte recognise antigen displayed by an antigen presenting cell (APC) in the context of class I MHC molecules. The functional coreceptor is either a homodimer composed of two alpha chains, or a heterodimer composed of one alpha and one beta chain. Both alpha and beta chains share significant homology to immunoglobulin variable light chains. CD8B is the CD8 beta chain isoforms.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using CD8B antibody (70R-5987) | CD8B antibody (70R-5987) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors