CDC2 antibody (70R-5615)

Rabbit polyclonal CDC2 antibody raised against the middle region of CDC2

Synonyms Polyclonal CDC2 antibody, Anti-CDC2 antibody, CDC-2 antibody, MGC111195 antibody, Cell Division Cycle 2 G1 To S And G2 To M antibody, CDK1 antibody, DKFZp686L20222 antibody, CDC2, CDC-2, CDC 2 antibody, CDC 2, CDC28A antibody
Specificity CDC2 antibody was raised against the middle region of CDC2
Cross Reactivity Human,Mouse,Rat,Arabidopsis,Drosophila
Applications WB
Immunogen CDC2 antibody was raised using the middle region of CDC2 corresponding to a region with amino acids CAICTLFYPYCQALQTEKEAPIASLGEGCPATLPSKSRQKTRPLIPEMCF
Assay Information CDC2 Blocking Peptide, catalog no. 33R-1643, is also available for use as a blocking control in assays to test for specificity of this CDC2 antibody


Western blot analysis using CDC2 antibody (70R-5615)

Recommended CDC2 Antibody Titration: 0.2-1 ug/ml


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 34 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of CDC2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The protein encoded by CDC2 is a member of the Ser/Thr protein kinase family. This protein is a catalytic subunit of the highly conserved protein kinase complex known as M-phase promoting factor (MPF), which is essential for G1/S and G2/M phase transitions of eukaryotic cell cycle. Mitotic cyclins stably associate with this protein and function as regulatory subunits. The kinase activity of this protein is controlled by cyclin accumulation and destruction through the cell cycle. The phosphorylation and dephosphorylation of this protein also play important regulatory roles in cell cycle control.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western blot analysis using CDC2 antibody (70R-5615) | Recommended CDC2 Antibody Titration: 0.2-1 ug/ml

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors