CDC25B antibody (70R-5503)

Rabbit polyclonal CDC25B antibody

Synonyms Polyclonal CDC25B antibody, Anti-CDC25B antibody, CDC-25 antibody, CDC 25 antibody, CDC-25, CDC25, CDC 25, Cell Division Cycle 25 Homolog B antibody
Cross Reactivity Human,Dog
Applications IHC, WB
Immunogen CDC25B antibody was raised using a synthetic peptide corresponding to a region with amino acids TQTMHDLAGLGSETPKSQVGTLLFRSRSRLTHLSLSRRASESSLSSESSE
Assay Information CDC25B Blocking Peptide, catalog no. 33R-9253, is also available for use as a blocking control in assays to test for specificity of this CDC25B antibody


Immunohistochemical staining using CDC25B antibody (70R-5503)

CDC25B antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Epithelial cells of renal tubule (arrows) in Human Kidney. Magnification is at 400X


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 65 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of CDC25B antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 0.25 ug/ml; IHC: 4-8 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance CDC25B is a member of the CDC25 family of phosphatases. CDC25B activates the cyclin dependent kinase CDC2 by removing two phosphate groups and it is required for entry into mitosis. CDC25B shuttles between the nucleus and the cytoplasm due to nuclear localization and nuclear export signals. The protein is nuclear in the M and G1 phases of the cell cycle and moves to the cytoplasm during S and G2. CDC25B has oncogenic properties, although its role in tumor formation has not been determined.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Immunohistochemical staining using CDC25B antibody (70R-5503) | CDC25B antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Epithelial cells of renal tubule (arrows) in Human Kidney. Magnification is at 400X
  • Western Blot analysis using CDC25B antibody (70R-5503) | CDC25B antibody (70R-5503) used at 0.25 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors