CDC45L antibody (70R-5557)

Rabbit polyclonal CDC45L antibody

Synonyms Polyclonal CDC45L antibody, Anti-CDC45L antibody, CDC45, PORC-PI-1 antibody, CDC45L2 antibody, CDC-45 antibody, CDC-45, CDC45 antibody, Cdc45 Cell Division Cycle 45-Like antibody, CDC 45, CDC 45 antibody
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen CDC45L antibody was raised using a synthetic peptide corresponding to a region with amino acids VTVVGIPPETDSSDRKNFFGRAFEKAAESTSSRMLHNHFDLSVIELKAED
Assay Information CDC45L Blocking Peptide, catalog no. 33R-9861, is also available for use as a blocking control in assays to test for specificity of this CDC45L antibody


Western Blot analysis using CDC45L antibody (70R-5557)

CDC45L antibody (70R-5557) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 65 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of CDC45L antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance CDC45L was identified by its strong similarity with Saccharomyces cerevisiae Cdc45, an essential protein required to the initiation of DNA replication. Cdc45 is a member of the highly conserved multiprotein complex including Cdc6/Cdc18, the minichromosome maintenance proteins (MCMs) and DNA polymerase, which is important for early steps of DNA replication in eukaryotes.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using CDC45L antibody (70R-5557) | CDC45L antibody (70R-5557) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors