CDH16 antibody (70R-6155)

Rabbit polyclonal CDH16 antibody raised against the N terminal of CDH16

Synonyms Polyclonal CDH16 antibody, Anti-CDH16 antibody, Cadherin 16 Ksp-Cadherin antibody
Specificity CDH16 antibody was raised against the N terminal of CDH16
Cross Reactivity Human
Applications WB
Immunogen CDH16 antibody was raised using the N terminal of CDH16 corresponding to a region with amino acids SDRDEPGTANSDLRFHILSQAPAQPSPDMFQLEPRLGALALSPKGSTSLD
Assay Information CDH16 Blocking Peptide, catalog no. 33R-8368, is also available for use as a blocking control in assays to test for specificity of this CDH16 antibody

Images

Western Blot analysis using CDH16 antibody (70R-6155)

CDH16 antibody (70R-6155) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 88 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of CDH16 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance CDH16 is a member of the cadherin superfamily, which are calcium-dependent, membrane-associated glycoproteins. CDH16 consists of an extracellular domain containing 6 cadherin domains, a transmembrane region and a truncated cytoplasmic domain but lacks the prosequence and tripeptide HAV adhesion recognition sequence typical of most classical cadherins. Expression is exclusively in kidney, where the protein functions as the principal mediator of homotypic cellular recognition, playing a role in the morphogenic direction of tissue development.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using CDH16 antibody (70R-6155) | CDH16 antibody (70R-6155) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors